SCOPe 2.06: Domain d1c9ea_: 1c9e A:

Lineage for d1c9ea_ (1c9e A:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.92: Chelatase-like [53799] (3 superfamilies)
   duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.92.1: Chelatase [53800] (4 families)
   interdomain linker is short; swapping of C-terminal helices between the two domains

5. Family c.92.1.1: Ferrochelatase [53801] (2 proteins)
   automatically mapped to Pfam PF00762

6. Protein Ferrochelatase [53802] (3 species)

7. Species Bacillus subtilis [TaxId:1423] [53803] (15 PDB entries)

8. Domain d1c9ea_: 1c9e A: [35595]
   complexed with mg, mp1

Details for d1c9ea_

PDB Entry: 1c9e, 2.3 Å

PDB Description: structure of ferrochelatase with copper(ii) n-methylmesoporphyrin complex bound at the active site

PDB Compounds: (A:) protoheme ferrolyase

SCOPe Domain Sequences for d1c9ea_:

Sequence; same for both SEQRES and ATOM records:

>d1c9ea_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsahs
lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
lkklgr

Timeline for d1c9ea_:

• d1c9ea_ first appeared (with stable ids) in SCOP 1.55
  
• d1c9ea_ appears in SCOPe 2.05
  
• d1c9ea_ appears in SCOPe 2.07
  
• d1c9ea_ appears in the current release, SCOPe 2.08