Lineage for d1ak1__ (1ak1 -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.92: Chelatase-like [53799] (2 superfamilies) 
Superfamily c.92.1: Chelatase [53800] (2 families) 
Family c.92.1.1: Ferrochelatase [53801] (1 protein) Protein Ferrochelatase [53802] (1 species) Species Bacillus subtilis [TaxId:1423] [53803] (4 PDB entries) 
Domain d1ak1__: 1ak1 - [35594]
Details for d1ak1__
PDB Entry: 1ak1 (more details), 1.9 Å
PDB Description: ferrochelatase from bacillus subtilis
SCOP Domain Sequences for d1ak1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ak1__ c.92.1.1 (-) Ferrochelatase {Bacillus subtilis}
rkkmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteq
qahnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsv
qsynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsa
hslpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdl
feqkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalat
vvlkklgr
SCOP Domain Coordinates for d1ak1__:
Click to download the PDB-style file with coordinates for d1ak1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ak1__:
- d1ak1__ appears in SCOP 1.57
- d1ak1__ appears in the current release, SCOPe 2.08, called d1ak1a_
View in 3D