Lineage for d5z2mc_ (5z2m C:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. Protein automated matches [190047] (37 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [186896] (12 PDB entries)
  8. Domain d5z2mc_: 5z2m C: [355939]
    Other proteins in same PDB: d5z2mb1, d5z2mb2, d5z2md1, d5z2md2
    automated match to d1yhna_
    complexed with gtp, mg

Details for d5z2mc_

PDB Entry: 5z2m (more details), 2.14 Å

PDB Description: structure of orp1l/rab7 complex
PDB Compounds: (C:) Ras-related protein Rab-7a

SCOPe Domain Sequences for d5z2mc_:

Sequence, based on SEQRES records: (download)

>d5z2mc_ c.37.1.8 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkvllkviilgdsgvgktslmnqyvnkkfsnqykatigadfltkevmvddrlvtmqiwdt
aglerfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlg
nkidlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalk

Sequence, based on observed residues (ATOM records): (download)

>d5z2mc_ c.37.1.8 (C:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kkvllkviilgdsgvgktslmnqyvnkkfsnqykaadfltkevmvddrlvtmqiwdtagl
erfqslgvafyrgadccvlvfdvtapntfktldswrdefliqasprdpenfpfvvlgnki
dlenrqvatkraqawcysknnipyfetsakeainveqafqtiarnalk

SCOPe Domain Coordinates for d5z2mc_ are not available.

Timeline for d5z2mc_:

Domains from other chains:
(mouse over for more information)
d5z2ma_, d5z2mb1, d5z2mb2, d5z2md1, d5z2md2