Lineage for d5y5ba_ (5y5b A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2996664Fold d.157: Metallo-hydrolase/oxidoreductase [56280] (1 superfamily)
    duplication of beta(4)-alpha-beta-alpha motif; 4 layers a/b/b/a; mixed beta-sheets
  4. 2996665Superfamily d.157.1: Metallo-hydrolase/oxidoreductase [56281] (16 families) (S)
  5. 2996666Family d.157.1.1: Zn metallo-beta-lactamase [56282] (2 proteins)
  6. 2996667Protein Zn metallo-beta-lactamase [56283] (14 species)
  7. 2996787Species Serratia marcescens [TaxId:615] [190018] (8 PDB entries)
  8. 2996790Domain d5y5ba_: 5y5b A: [355931]
    automated match to d1jjta_
    complexed with epe, so4, zn

Details for d5y5ba_

PDB Entry: 5y5b (more details), 1.7 Å

PDB Description: crystal structure of imp-1 metallo-beta-lactamase
PDB Compounds: (A:) Metallo-beta-lactamase type 2

SCOPe Domain Sequences for d5y5ba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y5ba_ d.157.1.1 (A:) Zn metallo-beta-lactamase {Serratia marcescens [TaxId: 615]}
slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
fvergykikgsisshfhsdstggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
lkskygkaklvvpshsevgdasllkltleqavkglneskkp

SCOPe Domain Coordinates for d5y5ba_:

Click to download the PDB-style file with coordinates for d5y5ba_.
(The format of our PDB-style files is described here.)

Timeline for d5y5ba_: