Lineage for d1c1ha_ (1c1h A:)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 845814Fold c.92: Chelatase-like [53799] (3 superfamilies)
    duplication: tandem repeat of two domains; 3 layers (a/b/a); parallel beta-sheet of 4 strands, order 2134
  4. 845815Superfamily c.92.1: Chelatase [53800] (3 families) (S)
    interdomain linker is short; swapping of C-terminal helices between the two domains
  5. 845816Family c.92.1.1: Ferrochelatase [53801] (1 protein)
  6. 845817Protein Ferrochelatase [53802] (3 species)
  7. 845818Species Bacillus subtilis [TaxId:1423] [53803] (8 PDB entries)
  8. 845821Domain d1c1ha_: 1c1h A: [35593]
    complexed with mmp, mo6

Details for d1c1ha_

PDB Entry: 1c1h (more details), 1.9 Å

PDB Description: crystal structure of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin
PDB Compounds: (A:) Ferrochelatase

SCOP Domain Sequences for d1c1ha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c1ha_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis [TaxId: 1423]}
kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsahs
lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
lkklgr

SCOP Domain Coordinates for d1c1ha_:

Click to download the PDB-style file with coordinates for d1c1ha_.
(The format of our PDB-style files is described here.)

Timeline for d1c1ha_: