Lineage for d1c1ha_ (1c1h A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.92: Chelatase-like [53799] (2 superfamilies) 
Superfamily c.92.1: Chelatase [53800] (2 families) 
Family c.92.1.1: Ferrochelatase [53801] (1 protein) Protein Ferrochelatase [53802] (1 species) Species Bacillus subtilis [TaxId:1423] [53803] (4 PDB entries) 
Domain d1c1ha_: 1c1h A: [35593]
Details for d1c1ha_
PDB Entry: 1c1h (more details), 1.9 Å
PDB Description: crystal structure of bacillus subtilis ferrochelatase in complex with n-methyl mesoporphyrin
SCOP Domain Sequences for d1c1ha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c1ha_ c.92.1.1 (A:) Ferrochelatase {Bacillus subtilis}
kmgllvmaygtpykeedieryythirrgrkpepemlqdlkdryeaiggisplaqiteqqa
hnleqhlneiqdeitfkayiglkhiepfiedavaemhkdgiteavsivlaphfstfsvqs
ynkrakeeaeklggltitsveswydepkfvtywvdrvketyasmpederenamlivsahs
lpekikefgdpypdqlhesakliaegagvseyavgwqsegntpdpwlgpdvqdltrdlfe
qkgyqafvyvpvgfvadhlevlydndyeckvvtddigasyyrpempnakpefidalatvv
lkklgr
SCOP Domain Coordinates for d1c1ha_:
Click to download the PDB-style file with coordinates for d1c1ha_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1c1ha_:
- d1c1ha_ appears in SCOP 1.57
- d1c1ha_ appears in the current release, SCOPe 2.08
View in 3D