Lineage for d5z2md1 (5z2m D:1-134)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.211: beta-hairpin-alpha-hairpin repeat [74651] (2 superfamilies)
    multiple repeats of beta(2)-alpha(2) motif
  4. Superfamily d.211.1: Ankyrin repeat [48403] (2 families) (S)
    repeats organized in elongated structures
  5. Family d.211.1.0: automated matches [191667] (1 protein)
    not a true family
  6. Protein automated matches [191267] (8 species)
    not a true protein
  7. Species Mouse (Mus musculus) [TaxId:10090] [355880] (2 PDB entries)
  8. Domain d5z2md1: 5z2m D:1-134 [355913]
    Other proteins in same PDB: d5z2ma_, d5z2mb2, d5z2mc_, d5z2md2
    automated match to d4drxe_
    complexed with gtp, mg

Details for d5z2md1

PDB Entry: 5z2m (more details), 2.14 Å

PDB Description: structure of orp1l/rab7 complex
PDB Compounds: (D:) Oxysterol-binding protein-related protein 1

SCOPe Domain Sequences for d5z2md1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5z2md1 d.211.1.0 (D:1-134) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
mnteaeqqllhharngnaeevrkllaamarmevvadidckgrsksnlgwtplhlacyfgh
kqvvedllkagakvnmlndmgdtplhraaftgrkelvlllleydadstvvngsgqtakea
thdkeirnmleave

SCOPe Domain Coordinates for d5z2md1 are not available.

Timeline for d5z2md1:

Domains from same chain:
(mouse over for more information)
d5z2md2
Domains from other chains:
(mouse over for more information)
d5z2ma_, d5z2mb1, d5z2mb2, d5z2mc_