Lineage for d5y2pb2 (5y2p B:159-311)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2966179Fold d.96: T-fold [55619] (2 superfamilies)
    beta(2)-alpha(2)-beta(2); 2 layers: alpha/beta; antiparallel sheet 1234
    tunnel-shaped: its known members form wide oligomeric barrels different sizes
  4. 2966180Superfamily d.96.1: Tetrahydrobiopterin biosynthesis enzymes-like [55620] (5 families) (S)
    bind purine or pterin in topologically similar sites between subunits
  5. 2966494Family d.96.1.4: Urate oxidase (uricase) [55633] (2 proteins)
    automatically mapped to Pfam PF01014
  6. 2966729Protein automated matches [254656] (4 species)
    not a true protein
  7. 2966814Species Bacillus sp. [TaxId:36824] [312567] (12 PDB entries)
  8. 2966830Domain d5y2pb2: 5y2p B:159-311 [355912]
    automated match to d1j2ga2
    complexed with aza, edo, k, oxy, so4

Details for d5y2pb2

PDB Entry: 5y2p (more details), 1.5 Å

PDB Description: crystal structure of bacillus sp. tb-90 urate oxidase improved by humidity control at 89% rh
PDB Compounds: (B:) Uric acid degradation bifunctional protein

SCOPe Domain Sequences for d5y2pb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y2pb2 d.96.1.4 (B:159-311) automated matches {Bacillus sp. [TaxId: 36824]}
dntlniteqqsglaglqlikvsgnsfvgfirdeyttlpedsnrplfvylnikwkyknted
sfgtnpenyvaaeqirdiatsvfhetetlsiqhliyligrrilerfpqlqevyfesqnht
wdkiveeipesegkvyteprppygfqcftvtqe

SCOPe Domain Coordinates for d5y2pb2:

Click to download the PDB-style file with coordinates for d5y2pb2.
(The format of our PDB-style files is described here.)

Timeline for d5y2pb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5y2pb1