Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.61: PRTase-like [53270] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
Superfamily c.61.1: PRTase-like [53271] (3 families) |
Family c.61.1.0: automated matches [191528] (1 protein) not a true family |
Protein automated matches [190891] (38 species) not a true protein |
Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries) |
Domain d5y4aa_: 5y4a A: [355908] automated match to d4mb6a_ complexed with cd, na, so4 |
PDB Entry: 5y4a (more details), 2.34 Å
SCOPe Domain Sequences for d5y4aa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5y4aa_ c.61.1.0 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]} ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg h
Timeline for d5y4aa_: