Lineage for d5y4aa_ (5y4a A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2891301Fold c.61: PRTase-like [53270] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 2891302Superfamily c.61.1: PRTase-like [53271] (3 families) (S)
  5. 2891861Family c.61.1.0: automated matches [191528] (1 protein)
    not a true family
  6. 2891862Protein automated matches [190891] (38 species)
    not a true protein
  7. 2892181Species Yersinia pseudotuberculosis [TaxId:273123] [227797] (8 PDB entries)
  8. 2892192Domain d5y4aa_: 5y4a A: [355908]
    automated match to d4mb6a_
    complexed with cd, na, so4

Details for d5y4aa_

PDB Entry: 5y4a (more details), 2.34 Å

PDB Description: cadmium directed assembly of adenine phosphoribosyltransferase from yersinia pseudotuberculosis.
PDB Compounds: (A:) Adenine phosphoribosyltransferase

SCOPe Domain Sequences for d5y4aa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5y4aa_ c.61.1.0 (A:) automated matches {Yersinia pseudotuberculosis [TaxId: 273123]}
ktaqqlkyikdsiktipdypkagilfrdvtsllenpkaysasiellsehysesgvtkvvg
teargflfgapvalalgvgfvpvrkpgklpretisesyeleygtdtleihtdsiqpgdkv
lvvddllatggtieatvklirrlggevvhaafiinlpelggearltqqgihcyslvsfdg
h

SCOPe Domain Coordinates for d5y4aa_:

Click to download the PDB-style file with coordinates for d5y4aa_.
(The format of our PDB-style files is described here.)

Timeline for d5y4aa_: