Lineage for d5wyna1 (5wyn A:8-210)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2404159Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins)
  6. 2404359Protein automated matches [190306] (9 species)
    not a true protein
  7. 2404387Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries)
  8. 2404395Domain d5wyna1: 5wyn A:8-210 [355902]
    Other proteins in same PDB: d5wyna2, d5wyna3
    automated match to d5fhta1
    complexed with cl, mes; mutant

Details for d5wyna1

PDB Entry: 5wyn (more details), 2.05 Å

PDB Description: htra2 pathogenic mutant
PDB Compounds: (A:) Serine protease HTRA2, mitochondrial

SCOPe Domain Sequences for d5wyna1:

Sequence, based on SEQRES records: (download)

>d5wyna1 b.47.1.1 (A:8-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv
adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam
gspfalqntitsgivcsaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigv
ntmkvtagisfaipsdrlreflh

Sequence, based on observed residues (ATOM records): (download)

>d5wyna1 b.47.1.1 (A:8-210) automated matches {Human (Homo sapiens) [TaxId: 9606]}
asprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv
adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam
gspfalqntitsgivcsaqnveyiqtdaaidfgnsggplvnldgevigvntmkvtagisf
aipsdrlreflh

SCOPe Domain Coordinates for d5wyna1:

Click to download the PDB-style file with coordinates for d5wyna1.
(The format of our PDB-style files is described here.)

Timeline for d5wyna1: