Class b: All beta proteins [48724] (178 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) |
Family b.47.1.1: Prokaryotic proteases [50495] (16 proteins) |
Protein automated matches [190306] (9 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [322167] (8 PDB entries) |
Domain d5wyna1: 5wyn A:8-210 [355902] Other proteins in same PDB: d5wyna2, d5wyna3 automated match to d5fhta1 complexed with cl, mes; mutant |
PDB Entry: 5wyn (more details), 2.05 Å
SCOPe Domain Sequences for d5wyna1:
Sequence, based on SEQRES records: (download)
>d5wyna1 b.47.1.1 (A:8-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} asprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam gspfalqntitsgivcsaqrpardlglpqtnveyiqtdaaidfgnsggplvnldgevigv ntmkvtagisfaipsdrlreflh
>d5wyna1 b.47.1.1 (A:8-210) automated matches {Human (Homo sapiens) [TaxId: 9606]} asprsqynfiadvvektapavvyieildrhpflgrevpisngsgfvvaadglivtnahvv adrrrvrvrllsgdtyeavvtavdpvadiatlriqtkeplptlplgrsadvrqgefvvam gspfalqntitsgivcsaqnveyiqtdaaidfgnsggplvnldgevigvntmkvtagisf aipsdrlreflh
Timeline for d5wyna1: