SCOPe 2.07: Domain d5y5cb_: 5y5c B:

Lineage for d5y5cb_ (5y5c B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein beta-Lactoglobulin [50827] (4 species)

7. Species Cow (Bos taurus) [TaxId:9913] [50828] (77 PDB entries)
   Uniprot P02754

8. Domain d5y5cb_: 5y5c B: [355894]
   automated match to d1bsqa_
   complexed with hxa

Details for d5y5cb_

PDB Entry: 5y5c, 2.61 Å

PDB Description: crystal structure of dha bind to bovine beta-lactoglobulin

PDB Compounds: (B:) beta-lactoglobulin

SCOPe Domain Sequences for d5y5cb_:

Sequence; same for both SEQRES and ATOM records:

>d5y5cb_ b.60.1.1 (B:) beta-Lactoglobulin {Cow (Bos taurus) [TaxId: 9913]}
qtmkgldiqkvagtwyslamaasdislldaqsaplrvyveelkptpegdleillqkweng
ecaqkkiiaektkipavfkidalnenkvlvldtdykkyllfcmensaepeqslacqclvr
tpevddealekfdkalkalpmhirlsfnptqleeqchi

Timeline for d5y5cb_:

• d5y5cb_ is new in SCOPe 2.07-stable
  
• d5y5cb_ appears in the current release, SCOPe 2.08