Lineage for d5wmka_ (5wmk A:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2470823Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2470824Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2472162Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2472163Protein automated matches [190151] (160 species)
    not a true protein
  7. 2473128Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)
  8. 3055831Domain d5wmka_: 5wmk A: [355893]
    automated match to d1j32a_
    complexed with bo3, mli; mutant

Details for d5wmka_

PDB Entry: 5wmk (more details), 1.4 Å

PDB Description: arabidopsis thaliana prephenate aminotransferase double mutant- t84v k169v
PDB Compounds: (A:) Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase

SCOPe Domain Sequences for d5wmka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5wmka_ c.67.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
slsprvqslkpskvmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegft
rytlnagitelreaicrklkeenglsyapdqilvsngavqsllqavlavcspgdeviipa
pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
amvpgdafgddscirisyatsldvlqaavekirkaleplratv

SCOPe Domain Coordinates for d5wmka_:

Click to download the PDB-style file with coordinates for d5wmka_.
(The format of our PDB-style files is described here.)

Timeline for d5wmka_:

  • d5wmka_ is new in SCOPe 2.07-stable