SCOPe 2.07: Domain d6ghdg1: 6ghd G:2-45

Lineage for d6ghdg1 (6ghd G:2-45)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.140: LEM/SAP HeH motif [63450] (6 superfamilies)
   helix-extended loop-helix; parallel helices

4. Superfamily a.140.1: LEM domain [63451] (1 family)

5. Family a.140.1.1: LEM domain [63452] (3 proteins)

6. Protein Inner nuclear membrane protein emerin [63455] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [63456] (5 PDB entries)

8. Domain d6ghdg1: 6ghd G:2-45 [355884]
   Other proteins in same PDB: d6ghda_, d6ghdb_, d6ghdc_, d6ghdd_, d6ghde_, d6ghdf_, d6ghdg2
   automated match to d1jeia_
   complexed with edo, so4

Details for d6ghdg1

PDB Entry: 6ghd, 2.1 Å

PDB Description: structural analysis of the ternary complex between lamin a/c, baf and emerin identifies an interface disrupted in autosomal recessive progeroid diseases

PDB Compounds: (G:) emerin

SCOPe Domain Sequences for d6ghdg1:

Sequence; same for both SEQRES and ATOM records:

>d6ghdg1 a.140.1.1 (G:2-45) Inner nuclear membrane protein emerin {Human (Homo sapiens) [TaxId: 9606]}
dnyadlsdtelttllrryniphgpvvgstrrlyekkifeyetqr

Timeline for d6ghdg1:

• d6ghdg1 is new in SCOPe 2.07-stable
  
• d6ghdg1 appears in the current release, SCOPe 2.08