Lineage for d2cbfa_ (2cbf A:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160460Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily)
    consists of two non-similar domains
    Domain 1 has parallel sheet of 5 strands, order 32415
    Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest
  4. 2160461Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) (S)
  5. 2160462Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins)
    Pfam PF00590
  6. 2160463Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species)
  7. 2160464Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries)
  8. 2160466Domain d2cbfa_: 2cbf A: [35588]
    complexed with sah

Details for d2cbfa_

PDB Entry: 2cbf (more details), 3.1 Å

PDB Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif, from bacillus megaterium, with the his-tag cleaved off
PDB Compounds: (A:) cobalt-precorrin-4 transmethylase

SCOPe Domain Sequences for d2cbfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cbfa_ c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]}
gshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagm
hleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaa
aaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefi
nagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp

SCOPe Domain Coordinates for d2cbfa_:

Click to download the PDB-style file with coordinates for d2cbfa_.
(The format of our PDB-style files is described here.)

Timeline for d2cbfa_: