Lineage for d2cbf__ (2cbf -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.90: Cobalt precorrin-4 methyltransferase CbiF [53789] (1 superfamily) Superfamily c.90.1: Cobalt precorrin-4 methyltransferase CbiF [53790] (1 family) 
Family c.90.1.1: Cobalt precorrin-4 methyltransferase CbiF [53791] (1 protein) Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species) Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries) 
Domain d2cbf__: 2cbf - [35588]
Details for d2cbf__
PDB Entry: 2cbf (more details), 3.1 Å
PDB Description: the x-ray structure of a cobalamin biosynthetic enzyme, cobalt precorrin-4 methyltransferase, cbif, from bacillus megaterium, with the his-tag cleaved off
SCOP Domain Sequences for d2cbf__:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbf__ c.90.1.1 (-) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium}
gshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagm
hleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaa
aaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefi
nagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp
SCOP Domain Coordinates for d2cbf__:
Click to download the PDB-style file with coordinates for d2cbf__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d2cbf__:
- d2cbf__ appears in SCOP 1.57
- d2cbf__ appears in the current release, SCOPe 2.08, called d2cbfa1
View in 3D