Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) |
Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species) |
Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries) |
Domain d2cbfa1: 2cbf A:21-251 [35588] Other proteins in same PDB: d2cbfa2 complexed with sah |
PDB Entry: 2cbf (more details), 3.1 Å
SCOPe Domain Sequences for d2cbfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cbfa1 c.90.1.1 (A:21-251) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]} mklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevlktagmhle emvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvtsvfaaaaaa eaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkvmkefinag wsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp
Timeline for d2cbfa1: