Lineage for d5wmia_ (5wmi A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. Protein automated matches [190151] (165 species)
    not a true protein
  7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)
  8. Domain d5wmia_: 5wmi A: [355872]
    automated match to d1j32a_
    complexed with akg; mutant

Details for d5wmia_

PDB Entry: 5wmi (more details), 2 Å

PDB Description: arabidopsis thaliana prephenate aminotransferase mutant- t84v
PDB Compounds: (A:) Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase

SCOPe Domain Sequences for d5wmia_:

Sequence, based on SEQRES records: (download)

>d5wmia_ c.67.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mslsprvqslkpskvmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegf
trytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviip
apywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvy
pkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafa
mtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayr
errdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfq
vamvpgdafgddscirisyatsldvlqaavekirkaleplrat

Sequence, based on observed residues (ATOM records): (download)

>d5wmia_ c.67.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mslsprvqslkpskvmvitdlaatlvsgvpvirlaagepdfdtpkvvaeaginairegft
rytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviipa
pywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvyp
kslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfskafam
tgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayre
rrdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfqv
amvpgdafgddscirisyatsldvlqaavekirkaleplrat

SCOPe Domain Coordinates for d5wmia_ are not available.

Timeline for d5wmia_: