![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.90: Tetrapyrrole methylase [53789] (1 superfamily) consists of two non-similar domains Domain 1 has parallel sheet of 5 strands, order 32415 Domain 2 has mixed sheet of 5 strands, order 12534; strands 4 & 5 are antiparallel to the rest |
![]() | Superfamily c.90.1: Tetrapyrrole methylase [53790] (2 families) ![]() |
![]() | Family c.90.1.1: Tetrapyrrole methylase [53791] (8 proteins) Pfam PF00590 |
![]() | Protein Cobalt precorrin-4 methyltransferase CbiF [53792] (1 species) |
![]() | Species Bacillus megaterium [TaxId:1404] [53793] (2 PDB entries) |
![]() | Domain d1cbfa_: 1cbf A: [35587] complexed with po4, sah |
PDB Entry: 1cbf (more details), 2.4 Å
SCOPe Domain Sequences for d1cbfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1cbfa_ c.90.1.1 (A:) Cobalt precorrin-4 methyltransferase CbiF {Bacillus megaterium [TaxId: 1404]} glvprgshmklyiigagpgdpdlitvkglkllqqadvvlyadslvsqdliakskpgaevl ktagmhleemvgtmldrmregkmvvrvhtgdpamygaimeqmvllkregvdieivpgvts vfaaaaaaeaeltipdltqtviltraegrtpvpefekltdlakhkctialflsstltkkv mkefinagwsedtpvvvvykatwpdekivrttvkdlddamrtngirkqamilagwaldp
Timeline for d1cbfa_: