Lineage for d5y2qb_ (5y2q B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2428807Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2428808Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2428809Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2428810Protein Acetylcholine binding protein (ACHBP) [63714] (1 species)
  7. 2428811Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [63715] (9 PDB entries)
  8. 2428879Domain d5y2qb_: 5y2q B: [355866]
    automated match to d1ux2a_
    complexed with 8l3

Details for d5y2qb_

PDB Entry: 5y2q (more details), 2.36 Å

PDB Description: x-ray structure of acetylcholine binding protein (achbp) complexed with a small molecule
PDB Compounds: (B:) acetylcholine-binding protein

SCOPe Domain Sequences for d5y2qb_:

Sequence, based on SEQRES records: (download)

>d5y2qb_ b.96.1.1 (B:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkkn
svtysccpeayedvevslnfrkkg

Sequence, based on observed residues (ATOM records): (download)

>d5y2qb_ b.96.1.1 (B:) Acetylcholine binding protein (ACHBP) {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
dradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsdr
tlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqrf
scdvsgvdtesgatcrikigswthhsreisvdptseyfsqysrfeildvtqkknsvtysc
cpeayedvevslnfrkkg

SCOPe Domain Coordinates for d5y2qb_:

Click to download the PDB-style file with coordinates for d5y2qb_.
(The format of our PDB-style files is described here.)

Timeline for d5y2qb_: