Lineage for d6emhb_ (6emh B:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. Species Human (Homo sapiens) [TaxId:9606] [56138] (50 PDB entries)
  8. Domain d6emhb_: 6emh B: [355861]
    automated match to d3elja_
    complexed with bge, bme, c15, cl, edo, gol, peg

Details for d6emhb_

PDB Entry: 6emh (more details), 1.7600000000000002 Å

PDB Description: crystal structure of jnk3 in complex with a pyridinylimidazole inhibitor
PDB Compounds: (B:) Mitogen-activated protein kinase 10

SCOPe Domain Sequences for d6emhb_:

Sequence, based on SEQRES records: (download)

>d6emhb_ d.144.1.7 (B:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqtha
krayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldher
msyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyvv
tryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpe
fmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpa
krisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d6emhb_ d.144.1.7 (B:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
nqfysvevgdstftvlkryqnlkpiivcaaydavldrnvaikklsrpfqnqthakrayre
lvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhermsylly
qmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmvtryyrapevil
gmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkklqptvrn
yvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakrisvddalqh
pyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

SCOPe Domain Coordinates for d6emhb_ are not available.

Timeline for d6emhb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d6emha_, d6emhc_, d6emhd_