SCOPe 2.07: Domain d5wmla_: 5wml A:

Lineage for d5wmla_ (5wml A:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (160 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [267816] (20 PDB entries)

8. Domain d5wmla_: 5wml A: [355842]
   automated match to d1j32a_
   complexed with glu, pmp; mutant

Details for d5wmla_

PDB Entry: 5wml, 2.1 Å

PDB Description: arabidopsis thaliana prephenate aminotransferase mutant- k306a

PDB Compounds: (A:) Bifunctional aspartate aminotransferase and glutamate/aspartate-prephenate aminotransferase

SCOPe Domain Sequences for d5wmla_:

Sequence; same for both SEQRES and ATOM records:

>d5wmla_ c.67.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
mslsprvqslkpsktmvitdlaatlvqsgvpvirlaagepdfdtpkvvaeaginairegf
trytlnagitelreaicrklkeenglsyapdqilvsngakqsllqavlavcspgdeviip
apywvsyteqarladatpvviptkisnnflldpkdlesklteksrllilcspsnptgsvy
pkslleeiariiakhprllvlsdeiyehiiyapathtsfaslpdmyertltvngfsaafa
mtgwrlgylagpkhivaacsklqgqvssgassiaqkagvaalglgkaggetvaemvkayr
errdflvkslgdikgvkisepqgafylfidfsayygseaegfglindssslalyfldkfq
vamvpgdafgddscirisyatsldvlqaavekirkaleplratv

Timeline for d5wmla_:

• d5wmla_ is new in SCOPe 2.07-stable
  
• d5wmla_ appears in the current release, SCOPe 2.08