Lineage for d6pfkb_ (6pfk B:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2160403Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2160404Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2160405Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 2160406Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 2160407Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)
  8. 2160423Domain d6pfkb_: 6pfk B: [35584]
    complexed with pga

Details for d6pfkb_

PDB Entry: 6pfk (more details), 2.6 Å

PDB Description: phosphofructokinase, inhibited t-state
PDB Compounds: (B:) phosphofructokinase

SCOPe Domain Sequences for d6pfkb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfkb_ c.89.1.1 (B:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOPe Domain Coordinates for d6pfkb_:

Click to download the PDB-style file with coordinates for d6pfkb_.
(The format of our PDB-style files is described here.)

Timeline for d6pfkb_: