Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.5: Flavoproteins [52218] (9 families) |
Family c.23.5.0: automated matches [191330] (1 protein) not a true family |
Protein automated matches [190158] (31 species) not a true protein |
Species Methanosarcina acetivorans [TaxId:188937] [355834] (1 PDB entry) |
Domain d5widc_: 5wid C: [355835] automated match to d5nula_ complexed with act, fmn, mrd |
PDB Entry: 5wid (more details), 1.68 Å
SCOPe Domain Sequences for d5widc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5widc_ c.23.5.0 (C:) automated matches {Methanosarcina acetivorans [TaxId: 188937]} mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh kptdkdlqeckrlgidiaekvkhk
Timeline for d5widc_: