Lineage for d5widc_ (5wid C:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2856357Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. 2856900Family c.23.5.0: automated matches [191330] (1 protein)
    not a true family
  6. 2856901Protein automated matches [190158] (31 species)
    not a true protein
  7. 2857002Species Methanosarcina acetivorans [TaxId:188937] [355834] (1 PDB entry)
  8. 2857005Domain d5widc_: 5wid C: [355835]
    automated match to d5nula_
    complexed with act, fmn, mrd

Details for d5widc_

PDB Entry: 5wid (more details), 1.68 Å

PDB Description: structure of a flavodoxin from the domain archaea
PDB Compounds: (C:) flavodoxin

SCOPe Domain Sequences for d5widc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5widc_ c.23.5.0 (C:) automated matches {Methanosarcina acetivorans [TaxId: 188937]}
mkaivvylstsgntkamaeaigngiesknvdvqvisfydvkldelkeaeaiavgsstfyy
kmllpmekfmdetlvasnpqgkigaafgsygwsgeapiliaekmremgmtvmdpvlrilh
kptdkdlqeckrlgidiaekvkhk

SCOPe Domain Coordinates for d5widc_:

Click to download the PDB-style file with coordinates for d5widc_.
(The format of our PDB-style files is described here.)

Timeline for d5widc_: