SCOPe 2.05: Domain d6pfka_: 6pfk A:

Lineage for d6pfka_ (6pfk A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.89: Phosphofructokinase [53783] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
   Domain 2 has parallel sheet of 4 strands, order 2314

4. Superfamily c.89.1: Phosphofructokinase [53784] (2 families)

5. Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)

6. Protein ATP-dependent phosphofructokinase [53786] (2 species)
   Domain 1 binds ATP

7. Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)

8. Domain d6pfka_: 6pfk A: [35583]
   complexed with pga

Details for d6pfka_

PDB Entry: 6pfk, 2.6 Å

PDB Description: phosphofructokinase, inhibited t-state

PDB Compounds: (A:) phosphofructokinase

SCOPe Domain Sequences for d6pfka_:

Sequence; same for both SEQRES and ATOM records:

>d6pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

Timeline for d6pfka_:

• d6pfka_ first appeared (with stable ids) in SCOP 1.55
  
• d6pfka_ appears in SCOPe 2.04
  
• d6pfka_ appears in SCOPe 2.06
  
• d6pfka_ appears in the current release, SCOPe 2.08