Lineage for d6pfka_ (6pfk A:)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 75053Fold c.89: Phosphofructokinase [53783] (1 superfamily)
  4. 75054Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 75055Family c.89.1.1: Phosphofructokinase [53785] (1 protein)
  6. 75056Protein Phosphofructokinase [53786] (2 species)
  7. 75057Species Bacillus stearothermophilus [TaxId:1422] [53788] (3 PDB entries)
  8. 75060Domain d6pfka_: 6pfk A: [35583]

Details for d6pfka_

PDB Entry: 6pfk (more details), 2.6 Å

PDB Description: phosphofructokinase, inhibited t-state

SCOP Domain Sequences for d6pfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pfka_ c.89.1.1 (A:) Phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgieglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOP Domain Coordinates for d6pfka_:

Click to download the PDB-style file with coordinates for d6pfka_.
(The format of our PDB-style files is described here.)

Timeline for d6pfka_: