Lineage for d5ns8a1 (5ns8 A:2-439)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832863Species Marine metagenome [TaxId:408172] [355785] (2 PDB entries)
  8. 2832867Domain d5ns8a1: 5ns8 A:2-439 [355817]
    Other proteins in same PDB: d5ns8a2, d5ns8b2, d5ns8c2
    automated match to d1uz1b_
    complexed with gol, noj, so4; mutant

Details for d5ns8a1

PDB Entry: 5ns8 (more details), 1.55 Å

PDB Description: crystal structure of beta-glucosidase bglm-g1 mutant h75r from marine metagenome in complex with inhibitor 1-deoxynojirimycin
PDB Compounds: (A:) beta-glucosidase M - G1

SCOPe Domain Sequences for d5ns8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ns8a1 c.1.8.0 (A:2-439) automated matches {Marine metagenome [TaxId: 408172]}
kkwgdmftwgvstssyqiegaanqggrgpsiwdtfskipgavangdngdvacdhyhryne
dldlmkwlgvgayrfsiawprvipsgygalnkegmdfydrlidgalergitpwptlyhwd
lpqslqdkggwnnrdcaywfaeysqkmaeafsdrlknwitinepfcsawlghlygvmapg
ikdlktginashhlllghglatkairevsselkvgitlnftpaitlgessedklavelad
gfdnrwfgdpvfkakypedivkafgkevpihpgdmeiistpldylglnyyfrqtveydat
akplpykqvtapnvertgmgwevhaqsftellervskeykpkeifitengsawddevvdg
kvddpnrvsylerhldamfaaknkgvpisgyfawslidnfewaygyakrfgiiyvdyqtq
kripkssayyyqkrikes

SCOPe Domain Coordinates for d5ns8a1:

Click to download the PDB-style file with coordinates for d5ns8a1.
(The format of our PDB-style files is described here.)

Timeline for d5ns8a1: