Lineage for d3pfk__ (3pfk -)

  1. Root: SCOP 1.59
  2. 115903Class c: Alpha and beta proteins (a/b) [51349] (113 folds)
  3. 127871Fold c.89: Phosphofructokinase [53783] (1 superfamily)
  4. 127872Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 127873Family c.89.1.1: Phosphofructokinase [53785] (1 protein)
  6. 127874Protein Phosphofructokinase [53786] (2 species)
  7. 127875Species Bacillus stearothermophilus [TaxId:1422] [53788] (3 PDB entries)
  8. 127876Domain d3pfk__: 3pfk - [35581]

Details for d3pfk__

PDB Entry: 3pfk (more details), 2.4 Å

PDB Description: phosphofructokinase. structure and control

SCOP Domain Sequences for d3pfk__:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfk__ c.89.1.1 (-) Phosphofructokinase {Bacillus stearothermophilus}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgiqglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOP Domain Coordinates for d3pfk__:

Click to download the PDB-style file with coordinates for d3pfk__.
(The format of our PDB-style files is described here.)

Timeline for d3pfk__: