Lineage for d3pfka_ (3pfk A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2911725Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2911726Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2911727Family c.89.1.1: Phosphofructokinase [53785] (3 proteins)
  6. 2911728Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 2911729Species Bacillus stearothermophilus [TaxId:1422] [53788] (8 PDB entries)
  8. 2911734Domain d3pfka_: 3pfk A: [35581]
    complexed with po4

Details for d3pfka_

PDB Entry: 3pfk (more details), 2.4 Å

PDB Description: phosphofructokinase. structure and control
PDB Compounds: (A:) phosphofructokinase

SCOPe Domain Sequences for d3pfka_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Bacillus stearothermophilus [TaxId: 1422]}
mkrigvltsggdspgmnaairsvvrkaiyhgvevygvyhgyagliagnikklevgdvgdi
ihrggtilytarcpefkteegqkkgieqlkkhgiqglvviggdgsyqgakkltehgfpcv
gvpgtidndipgtdftigfdtalntvidaidkirdtatshertyvievmgrhagdialws
glaggaetilipeadydmndviarlkrghergkkhsiiivaegvgsgvdfgrqiqeatgf
etrvtvlghvqrggsptafdrvlasrlgaravelllegkggrcvgiqnnqlvdhdiaeal
ankhtidqrmyalskelsi

SCOPe Domain Coordinates for d3pfka_:

Click to download the PDB-style file with coordinates for d3pfka_.
(The format of our PDB-style files is described here.)

Timeline for d3pfka_: