Lineage for d5oijb_ (5oij B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395721Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2395722Species Human (Homo sapiens) [TaxId:9606] [74932] (11 PDB entries)
  8. 2395744Domain d5oijb_: 5oij B: [355802]
    automated match to d5w72a_
    mutant

Details for d5oijb_

PDB Entry: 5oij (more details), 1.8 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332g mutant: space group i4122
PDB Compounds: (B:) Disks large homolog 4

SCOPe Domain Sequences for d5oijb_:

Sequence, based on SEQRES records: (download)

>d5oijb_ b.36.1.1 (B:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
rrivihrgstglgfnivggeggegifisfilaggpadlsgelrkgdqilsvngvdlrnas
heqaaialknagqtvtiiaqykpeeysrfeak

Sequence, based on observed residues (ATOM records): (download)

>d5oijb_ b.36.1.1 (B:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
rrivihrgstglgfnivgifisfilaggpadlsgelrkgdqilsvngvsheqaaialkna
gqtvtiiaqykpeeysrfeak

SCOPe Domain Coordinates for d5oijb_:

Click to download the PDB-style file with coordinates for d5oijb_.
(The format of our PDB-style files is described here.)

Timeline for d5oijb_:

  • d5oijb_ is new in SCOPe 2.07-stable
  • d5oijb_ does not appear in SCOPe 2.08

View in 3D
Domains from other chains:
(mouse over for more information)
d5oija_