Lineage for d6ghdb_ (6ghd B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374966Superfamily b.1.16: Lamin A/C globular tail domain [74853] (2 families) (S)
  5. 2374967Family b.1.16.1: Lamin A/C globular tail domain [74854] (2 proteins)
    automatically mapped to Pfam PF00932
  6. 2374974Protein automated matches [191072] (1 species)
    not a true protein
  7. 2374975Species Human (Homo sapiens) [TaxId:9606] [188979] (3 PDB entries)
  8. 2374980Domain d6ghdb_: 6ghd B: [355800]
    Other proteins in same PDB: d6ghda_, d6ghdc_, d6ghdd_, d6ghde_, d6ghdg1, d6ghdg2, d6ghdh_
    automated match to d1ivta_
    complexed with edo, so4

Details for d6ghdb_

PDB Entry: 6ghd (more details), 2.1 Å

PDB Description: structural analysis of the ternary complex between lamin a/c, baf and emerin identifies an interface disrupted in autosomal recessive progeroid diseases
PDB Compounds: (B:) Prelamin-A/C

SCOPe Domain Sequences for d6ghdb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6ghdb_ b.1.16.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ssfsqhartsgrvaveevdeegkfvrlrnksnedqsmgnwqikrqngddplltyrfppkf
tlkagqvvtiwaagagathspptdlvwkaqntwgcgnslrtalinstgeevamrklvrs

SCOPe Domain Coordinates for d6ghdb_:

Click to download the PDB-style file with coordinates for d6ghdb_.
(The format of our PDB-style files is described here.)

Timeline for d6ghdb_: