Lineage for d5oi6d_ (5oi6 D:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2395482Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2395483Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2395484Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2395721Protein Synaptic protein PSD-95 [50162] (2 species)
    Synonym: synapse associated protein 90, sap90
    duplication: contains three PDZ domains
  7. 2395722Species Human (Homo sapiens) [TaxId:9606] [74932] (11 PDB entries)
  8. 2395750Domain d5oi6d_: 5oi6 D: [355798]
    automated match to d5w72a_
    mutant

Details for d5oi6d_

PDB Entry: 5oi6 (more details), 2 Å

PDB Description: crystal structure of the third pdz domain of psd-95 protein d332p mutant: space group c121, structure 2
PDB Compounds: (D:) Disks large homolog 4

SCOPe Domain Sequences for d5oi6d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5oi6d_ b.36.1.1 (D:) Synaptic protein PSD-95 {Human (Homo sapiens) [TaxId: 9606]}
ipreprrivihrgstglgfnivggepgegifisfilaggpadlsgelrkgdqilsvngvd
lrnasheqaaialknagqtvtiiaqykpeeysrfeak

SCOPe Domain Coordinates for d5oi6d_:

Click to download the PDB-style file with coordinates for d5oi6d_.
(The format of our PDB-style files is described here.)

Timeline for d5oi6d_:

  • d5oi6d_ is new in SCOPe 2.07-stable
  • d5oi6d_ does not appear in SCOPe 2.08