SCOPe 2.07: Domain d6fktb1: 6fkt B:2-299

Lineage for d6fktb1 (6fkt B:2-299)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (31 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [355716] (12 PDB entries)

8. Domain d6fktb1: 6fkt B:2-299 [355795]
   Other proteins in same PDB: d6fkta2, d6fktb2
   automated match to d5vj0a_
   complexed with hem, mg

Details for d6fktb1

PDB Entry: 6fkt, 1.86 Å

PDB Description: crystal structure of a dye-decolorizing peroxidase r232a variant from klebsiella pneumoniae (kpdyp)

PDB Compounds: (B:) Iron-dependent peroxidase

SCOPe Domain Sequences for d6fktb1:

Sequence; same for both SEQRES and ATOM records:

>d6fktb1 d.58.4.0 (B:2-299) automated matches {Klebsiella pneumoniae [TaxId: 573]}
sqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavvafgn
nvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaafgdai
dvkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnlk
qlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivaqslpygtas
gthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriqal

Timeline for d6fktb1:

• d6fktb1 is new in SCOPe 2.07-stable
  
• d6fktb1 appears in the current release, SCOPe 2.08