Lineage for d2pfkc_ (2pfk C:)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27922Fold c.89: Phosphofructokinase [53783] (1 superfamily)
  4. 27923Superfamily c.89.1: Phosphofructokinase [53784] (1 family) (S)
  5. 27924Family c.89.1.1: Phosphofructokinase [53785] (1 protein)
  6. 27925Protein Phosphofructokinase [53786] (2 species)
  7. 27933Species Escherichia coli [TaxId:562] [53787] (2 PDB entries)
  8. 27938Domain d2pfkc_: 2pfk C: [35579]

Details for d2pfkc_

PDB Entry: 2pfk (more details), 2.4 Å

PDB Description: the crystal structure of unliganded phosphofructokinase from escherichia coli

SCOP Domain Sequences for d2pfkc_:

Sequence, based on SEQRES records: (download)

>d2pfkc_ c.89.1.1 (C:) Phosphofructokinase {Escherichia coli}
mikkigvltsggdapgmnaairgvvrsalteglevmgiydgylglyedrmvqldrysvsd
minrggtflgsarfpefrdeniravaienlkkrgidalvviggdgsymgamrltemgfpc
iglpgtidndikgtdytigfftaltsvveaidrlrdtssshqrisvvevmgrycgdltla
aaiaggcefvvvpevefsredlvneikagiakgkkhaivaitehmcdvdelahfieketg
retratvlghiqrggspvpydrilasrmgayaidlllagyggrcvgiqneqlvhhdiida
ie

Sequence, based on observed residues (ATOM records): (download)

>d2pfkc_ c.89.1.1 (C:) Phosphofructokinase {Escherichia coli}
mikkigvltsggdapgmnaairgvvrsalteglevmgiydgylglyedrmvqldrysvsd
minrggtflgsarfpefrdeniravaienlkkrgidalvviggdgsymgamrltemgfpc
iglpgtidndikgtdytigfftalstvveaidrlrdtssshqrisvvevmgrycgdltla
aaiaggcefvvvpevefsredlvneikagiakgkkhaivaitehmcdvdelahfieketg
retratvlghiqrggspvpydrilasrmgayaidlllagyggrcvgiqneqlvhhdiida
ie

SCOP Domain Coordinates for d2pfkc_:

Click to download the PDB-style file with coordinates for d2pfkc_.
(The format of our PDB-style files is described here.)

Timeline for d2pfkc_: