Lineage for d2pfkc_ (2pfk C:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142778Fold c.89: Phosphofructokinase [53783] (1 superfamily)
    consists of two non-similar domains, 3 layers (a/b/a) each
    Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
    Domain 2 has parallel sheet of 4 strands, order 2314
  4. 2142779Superfamily c.89.1: Phosphofructokinase [53784] (2 families) (S)
  5. 2142780Family c.89.1.1: Phosphofructokinase [53785] (3 protein domains)
  6. 2142781Protein ATP-dependent phosphofructokinase [53786] (2 species)
    Domain 1 binds ATP
  7. 2142813Species Escherichia coli [TaxId:562] [53787] (2 PDB entries)
  8. 2142818Domain d2pfkc_: 2pfk C: [35579]

Details for d2pfkc_

PDB Entry: 2pfk (more details), 2.4 Å

PDB Description: the crystal structure of unliganded phosphofructokinase from escherichia coli
PDB Compounds: (C:) 6-phosphofructokinase isozyme I

SCOPe Domain Sequences for d2pfkc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2pfkc_ c.89.1.1 (C:) ATP-dependent phosphofructokinase {Escherichia coli [TaxId: 562]}
mikkigvltsggdapgmnaairgvvrsalteglevmgiydgylglyedrmvqldrysvsd
minrggtflgsarfpefrdeniravaienlkkrgidalvviggdgsymgamrltemgfpc
iglpgtidndikgtdytigfftalstvveaidrlrdtssshqrisvvevmgrycgdltla
aaiaggcefvvvpevefsredlvneikagiakgkkhaivaitehmcdvdelahfieketg
retratvlghiqrggspvpydrilasrmgayaidlllagyggrcvgiqneqlvhhdiida
ie

SCOPe Domain Coordinates for d2pfkc_:

Click to download the PDB-style file with coordinates for d2pfkc_.
(The format of our PDB-style files is described here.)

Timeline for d2pfkc_: