Lineage for d6g6ya_ (6g6y A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2871581Family c.37.1.0: automated matches [191323] (1 protein)
    not a true family
  6. 2871582Protein automated matches [190123] (156 species)
    not a true protein
  7. 2872051Species Human (Homo sapiens) [TaxId:9606] [186862] (206 PDB entries)
  8. 2872120Domain d6g6ya_: 6g6y A: [355789]
    automated match to d3wpna_
    complexed with adp, eok, mg

Details for d6g6ya_

PDB Entry: 6g6y (more details), 1.8 Å

PDB Description: eg5-inhibitor complex
PDB Compounds: (A:) Kinesin-like protein KIF11

SCOPe Domain Sequences for d6g6ya_:

Sequence, based on SEQRES records: (download)

>d6g6ya_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtggladkssrktytfdmvfgast
kqidvyrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagii
prtlhqifekltdngtefsvkvslleiyneelfdllnpssdvserlqmfddprnkrgvii
kgleeitvhnkdevyqilekgaakrttaatlmnayssrshsvfsvtihmkettidgeelv
kigklnlvdlagsenigrsgavdkrareagninqslltlgrvitalvertphvpyreskl
trilqdslggrtrtsiiatispaslnleetlstleyahraknilnkpe

Sequence, based on observed residues (ATOM records): (download)

>d6g6ya_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kniqvvvrcrpfnlaerkasahsivecdpvrkevsvrtgssrktytfdmvfgastkqidv
yrsvvcpildevimgynctifaygqtgtgktftmegerspneeytweedplagiiprtlh
qifekltdngtefsvkvslleiyneelfdllnpserlqmfddprnkrgviikgleeitvh
nkdevyqilekgaakrttaatlmnayssrshsvfsvtihmketelvkigklnlvdlagse
nninqslltlgrvitalvertphvpyreskltrilqdslggrtrtsiiatispaslnlee
tlstleyahraknilnkpe

SCOPe Domain Coordinates for d6g6ya_:

Click to download the PDB-style file with coordinates for d6g6ya_.
(The format of our PDB-style files is described here.)

Timeline for d6g6ya_: