SCOPe 2.08: Domain d6bslb_: 6bsl B:

Lineage for d6bslb_ (6bsl B:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.0: automated matches [191495] (1 protein)
   not a true family

6. Protein automated matches [190805] (20 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188286] (69 PDB entries)

8. Domain d6bslb_: 6bsl B: [355781]
   automated match to d3edha_
   complexed with edo, evv, scn, zn

Details for d6bslb_

PDB Entry: 6bsl, 1.45 Å

PDB Description: bmp1 complexed with a reverse hydroxymate - compound 22

PDB Compounds: (B:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6bslb_:

Sequence; same for both SEQRES and ATOM records:

>d6bslb_ d.92.1.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcp

Timeline for d6bslb_:

• d6bslb_ first appeared in SCOPe 2.07