Lineage for d6gmxg_ (6gmx G:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2931196Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2931197Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2931198Family d.15.1.1: Ubiquitin-related [54237] (39 proteins)
    Pfam PF00240
  6. 2931223Protein Elongin B [54246] (2 species)
  7. 2931224Species Human (Homo sapiens) [TaxId:9606] [54247] (53 PDB entries)
  8. 2931345Domain d6gmxg_: 6gmx G: [355774]
    Other proteins in same PDB: d6gmxb_, d6gmxc_, d6gmxe1, d6gmxe2, d6gmxf_, d6gmxh_, d6gmxi_, d6gmxk1, d6gmxk2, d6gmxl_
    automated match to d1lqba_
    complexed with act, f7b, ipa

Details for d6gmxg_

PDB Entry: 6gmx (more details), 2.53 Å

PDB Description: pvhl:elob:eloc in complex with 6-chlorothiochroman-4-one
PDB Compounds: (G:) Elongin-B

SCOPe Domain Sequences for d6gmxg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6gmxg_ d.15.1.1 (G:) Elongin B {Human (Homo sapiens) [TaxId: 9606]}
mdvflmirrhkttiftdakesstvfelkrivegilkrppdeqrlykddqllddgktlgec
gftsqtarpqapatvglafraddtfealciepfssppelpdvm

SCOPe Domain Coordinates for d6gmxg_:

Click to download the PDB-style file with coordinates for d6gmxg_.
(The format of our PDB-style files is described here.)

Timeline for d6gmxg_: