Class b: All beta proteins [48724] (180 folds) |
Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
Superfamily b.3.3: VHL [49468] (1 family) automatically mapped to Pfam PF01847 |
Family b.3.3.1: VHL [49469] (2 proteins) |
Protein VHL [49470] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [49471] (41 PDB entries) |
Domain d6gmxl_: 6gmx L: [355771] Other proteins in same PDB: d6gmxa_, d6gmxb_, d6gmxd_, d6gmxe1, d6gmxe2, d6gmxg_, d6gmxh_, d6gmxj_, d6gmxk1, d6gmxk2 automated match to d1lqbc_ complexed with act, f7b, ipa |
PDB Entry: 6gmx (more details), 2.53 Å
SCOPe Domain Sequences for d6gmxl_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6gmxl_ b.3.3.1 (L:) VHL {Human (Homo sapiens) [TaxId: 9606]} vlrsvnsrepsqvifcnrsprvvlpvwlnfdgepqpyptlppgtgrrihsyrghlwlfrd agthdgllvnqtelfvpslnvdgqpifanitlpvytlkerclqvvrslvkpenyrrldiv rslyedledhpnvqkdlerltqer
Timeline for d6gmxl_: