SCOP 1.65: Domain d2pfka_: 2pfk A:

Lineage for d2pfka_ (2pfk A:)

1. Root: SCOP 1.65

2. Class c: Alpha and beta proteins (a/b) [51349] (121 folds)

3. Fold c.89: Phosphofructokinase [53783] (1 superfamily)
   consists of two non-similar domains, 3 layers (a/b/a) each
   Domain 1 has mixed sheet of 7 strands, order 3214567; strands 3 & 7 are antiparallel to the rest
   Domain 2 has parallel sheet of 4 strands, order 2314

4. Superfamily c.89.1: Phosphofructokinase [53784] (1 family)

5. Family c.89.1.1: Phosphofructokinase [53785] (2 proteins)

6. Protein ATP-dependent phosphofructokinase [53786] (2 species)
   Domain 1 binds ATP

7. Species Escherichia coli [TaxId:562] [53787] (2 PDB entries)

8. Domain d2pfka_: 2pfk A: [35577]

Details for d2pfka_

PDB Entry: 2pfk, 2.4 Å

PDB Description: the crystal structure of unliganded phosphofructokinase from escherichia coli

SCOP Domain Sequences for d2pfka_:

Sequence; same for both SEQRES and ATOM records:

>d2pfka_ c.89.1.1 (A:) ATP-dependent phosphofructokinase {Escherichia coli}
mikkigvltsggdapgmnaairgvvrsalteglevmgiydgylglyedrmvqldrysvsd
minrggtflgsarfpefrdeniravaienlkkrgidalvviggdgsymgamrltemgfpc
iglpgtidndikgtdytigfftalstvveaidrlrdtssshqrisvvevmgrycgdltla
aaiaggcefvvvpevefsredlvneikagiakgkkhaivaitehmcdvdelahfieketg
retratvlghiqrggspvpydrilasrmgayaidlllagyggrcvgiqneqlvhhdiida
i

Timeline for d2pfka_:

• d2pfka_ first appeared (with stable ids) in SCOP 1.55
  
• d2pfka_ appears in SCOP 1.63
  
• d2pfka_ appears in SCOP 1.67
  
• d2pfka_ appears in the current release, SCOPe 2.08