Lineage for d6e85a1 (6e85 A:1-328)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2905791Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily)
    consists of two intertwined (sub)domains related by pseudo dyad; duplication
    3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest
  4. 2905792Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) (S)
    the constituent families form similar dimers
  5. 2906251Family c.77.1.0: automated matches [191423] (1 protein)
    not a true family
  6. 2906252Protein automated matches [190603] (25 species)
    not a true protein
  7. 2906350Species Klebsiella pneumoniae [TaxId:72407] [355704] (1 PDB entry)
  8. 2906351Domain d6e85a1: 6e85 A:1-328 [355764]
    Other proteins in same PDB: d6e85a2
    automated match to d1yxoa_
    complexed with cl, fmt, ni, pop, so4

Details for d6e85a1

PDB Entry: 6e85 (more details), 1.25 Å

PDB Description: 1.25 angstrom resolution crystal structure of 4-hydroxythreonine-4- phosphate dehydrogenase from klebsiella pneumoniae.
PDB Compounds: (A:) D-threonate 4-phosphate dehydrogenase

SCOPe Domain Sequences for d6e85a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6e85a1 c.77.1.0 (A:1-328) automated matches {Klebsiella pneumoniae [TaxId: 72407]}
mskmiavtmgdpagigpeiiikslaegalsgapvvvvgcaqtlrrilalnitpraelrii
dhpaeasfspatinvideplsdpqglrpgevqaqagdlafrcirratalalegavaaiat
aplnkealhlaghaypghtellahltqttdyamvlyteklkvihitthislrqfldtlnq
prietvigvadrflrrvgyprpriavagvnphagenglfgdeeirivapavaamrakgve
vtgpcppdtvfmqchegmydmvvamyhdqghiplkllgfydgvnitaglpfirtsadhgt
afdiawtgkaksesmatsielamhiaqe

SCOPe Domain Coordinates for d6e85a1:

Click to download the PDB-style file with coordinates for d6e85a1.
(The format of our PDB-style files is described here.)

Timeline for d6e85a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6e85a2
View in 3D
Domains from other chains:
(mouse over for more information)
d6e85b_