![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.77: Isocitrate/Isopropylmalate dehydrogenase-like [53658] (1 superfamily) consists of two intertwined (sub)domains related by pseudo dyad; duplication 3 layers: a/b/a; single mixed beta-sheet of 10 strands, order 213A945867 (A=10); strands from 5 to 9 are antiparallel to the rest |
![]() | Superfamily c.77.1: Isocitrate/Isopropylmalate dehydrogenase-like [53659] (6 families) ![]() the constituent families form similar dimers |
![]() | Family c.77.1.0: automated matches [191423] (1 protein) not a true family |
![]() | Protein automated matches [190603] (25 species) not a true protein |
![]() | Species Klebsiella pneumoniae [TaxId:72407] [355704] (1 PDB entry) |
![]() | Domain d6e85a1: 6e85 A:1-328 [355764] Other proteins in same PDB: d6e85a2 automated match to d1yxoa_ complexed with cl, fmt, ni, pop, so4 |
PDB Entry: 6e85 (more details), 1.25 Å
SCOPe Domain Sequences for d6e85a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6e85a1 c.77.1.0 (A:1-328) automated matches {Klebsiella pneumoniae [TaxId: 72407]} mskmiavtmgdpagigpeiiikslaegalsgapvvvvgcaqtlrrilalnitpraelrii dhpaeasfspatinvideplsdpqglrpgevqaqagdlafrcirratalalegavaaiat aplnkealhlaghaypghtellahltqttdyamvlyteklkvihitthislrqfldtlnq prietvigvadrflrrvgyprpriavagvnphagenglfgdeeirivapavaamrakgve vtgpcppdtvfmqchegmydmvvamyhdqghiplkllgfydgvnitaglpfirtsadhgt afdiawtgkaksesmatsielamhiaqe
Timeline for d6e85a1: