Lineage for d6h00a_ (6h00 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2794132Fold b.45: Split barrel-like [50474] (3 superfamilies)
    barrel; n=6, S=10; greek-key
  4. 2794133Superfamily b.45.1: FMN-binding split barrel [50475] (5 families) (S)
    related to the ferredoxin reductase-like FAD-binding domain
  5. 2794134Family b.45.1.1: PNP-oxidase like [50476] (17 proteins)
  6. 2794251Protein automated matches [190383] (6 species)
    not a true protein
  7. 2794258Species Human (Homo sapiens) [TaxId:9606] [188118] (3 PDB entries)
  8. 2794262Domain d6h00a_: 6h00 A: [355760]
    automated match to d3hy8a_
    complexed with edo, fmn, so4

Details for d6h00a_

PDB Entry: 6h00 (more details), 1.66 Å

PDB Description: crystal structure of human pyridoxine 5-phophate oxidase, r116q variant
PDB Compounds: (A:) Pyridoxine-5'-phosphate oxidase

SCOPe Domain Sequences for d6h00a_:

Sequence, based on SEQRES records: (download)

>d6h00a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfrff
tnfesqkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqigav
vshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhdri
vfrrglptgdsplgpmthrgeedwlyerlap

Sequence, based on observed residues (ATOM records): (download)

>d6h00a_ b.45.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
thltsldpvkqfaawfeeavqcpdigeanamclatctrdgkpsarmlllkgfgkdgfrff
tnfesqkgkeldsnpfaslvfyweplnrqvrvegpvkklpeeeaecyfhsrpkssqigav
vshqssvipdreylrkkneeleqlyqdqevpkpkswggyvlypqvmefwqgqtnrlhdri
vfrrglgpmthrgeedwlyerlap

SCOPe Domain Coordinates for d6h00a_:

Click to download the PDB-style file with coordinates for d6h00a_.
(The format of our PDB-style files is described here.)

Timeline for d6h00a_: