Lineage for d6btna_ (6btn A:)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families) (S)
  5. Family d.92.1.0: automated matches [191495] (1 protein)
    not a true family
  6. Protein automated matches [190805] (19 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [188286] (68 PDB entries)
  8. Domain d6btna_: 6btn A: [355752]
    automated match to d3edha_
    complexed with e8m, edo, zn

Details for d6btna_

PDB Entry: 6btn (more details), 2.05 Å

PDB Description: bmp1 complexed with a reverse hydroxymate - compound 1
PDB Compounds: (A:) Bone morphogenetic protein 1

SCOPe Domain Sequences for d6btna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6btna_ d.92.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
aatsrpervwpdgvipfviggnftgsqravfrqamrhwekhtcvtflertdedsyivfty
rpcgccsyvgrrgggpqaisigkncdkfgivvhelghvvgfwhehtrpdrdrhvsivren
iqpgqeynflkmepqeveslgetydfdsimhyarntfsrgifldtivpkyevngvkppig
qrtrlskgdiaqarklykcpa

SCOPe Domain Coordinates for d6btna_ are not available.

Timeline for d6btna_:

Domains from other chains:
(mouse over for more information)
d6btnb_