Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.42: POZ domain [54694] (1 superfamily) core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143 |
Superfamily d.42.1: POZ domain [54695] (3 families) |
Family d.42.1.1: BTB/POZ domain [54696] (6 proteins) |
Protein Elongin C [54699] (3 species) |
Species Human (Homo sapiens) [TaxId:9606] [54700] (56 PDB entries) |
Domain d6gmxb_: 6gmx B: [355732] Other proteins in same PDB: d6gmxa_, d6gmxc_, d6gmxd_, d6gmxe2, d6gmxf_, d6gmxg_, d6gmxi_, d6gmxj_, d6gmxk2, d6gmxl_ automated match to d1lm8c_ complexed with act, f7b, ipa |
PDB Entry: 6gmx (more details), 2.53 Å
SCOPe Domain Sequences for d6gmxb_:
Sequence, based on SEQRES records: (download)
>d6gmxb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlsgpgqfaenetnevnfreipshvlskvcmy ftykvrytnssteipefpiapeialellmaanfldc
>d6gmxb_ d.42.1.1 (B:) Elongin C {Human (Homo sapiens) [TaxId: 9606]} myvklissdghefivkrehaltsgtikamlstnevnfreipshvlskvcmyftykvrytn ssteipefpiapeialellmaanfldc
Timeline for d6gmxb_: