SCOPe 2.08: Domain d6avkb_: 6avk B:

Lineage for d6avkb_ (6avk B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.61: Streptavidin-like [50875] (8 superfamilies)
   barrel, closed; n=8, S=10; meander

4. Superfamily b.61.1: Avidin/streptavidin [50876] (2 families)

5. Family b.61.1.1: Avidin/streptavidin [50877] (3 proteins)

6. Protein Streptavidin [50878] (1 species)

7. Species Streptomyces avidinii [TaxId:1895] [50879] (128 PDB entries)

8. Domain d6avkb_: 6avk B: [355724]
   automated match to d1vwlb_
   complexed with bz4, hdo

Details for d6avkb_

PDB Entry: 6avk, 1.4 Å

PDB Description: streptavidin bound to peptide-like compound kpm-6

PDB Compounds: (B:) streptavidin

SCOPe Domain Sequences for d6avkb_:

Sequence; same for both SEQRES and ATOM records:

>d6avkb_ b.61.1.1 (B:) Streptavidin {Streptomyces avidinii [TaxId: 1895]}
eagitgtwynqlgstfivtagadgaltgtyesavgnaesryvltgrydsapatdgsgtal
gwtvawknnyrnahsattwsgqyvggaearintqwlltsgtteanawkstlvghdtftkv
k

Timeline for d6avkb_:

• d6avkb_ first appeared in SCOPe 2.07