Lineage for d6exwa_ (6exw A:)

  1. Root: SCOPe 2.08
  2. 3029608Class g: Small proteins [56992] (100 folds)
  3. 3038051Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 3038052Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 3038053Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 3038187Protein automated matches [190700] (1 species)
    not a true protein
  7. 3038188Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)
  8. 3038236Domain d6exwa_: 6exw A: [355713]
    automated match to d1qbha_
    complexed with c3k, zn

Details for d6exwa_

PDB Entry: 6exw (more details), 2.2 Å

PDB Description: crystal structure of ciap1-bir3 in complex with a covalently bound sm
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d6exwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6exwa_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgryphlle

SCOPe Domain Coordinates for d6exwa_:

Click to download the PDB-style file with coordinates for d6exwa_.
(The format of our PDB-style files is described here.)

Timeline for d6exwa_: