Lineage for d3pga3_ (3pga 3:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142688Protein Glutaminase-asparaginase [53780] (2 species)
  7. 2142691Species Pseudomonas sp., 7A [TaxId:306] [53782] (4 PDB entries)
  8. 2142698Domain d3pga3_: 3pga 3: [35571]

Details for d3pga3_

PDB Entry: 3pga (more details), 2 Å

PDB Description: structural characterization of pseudomonas 7a glutaminase-asparaginase
PDB Compounds: (3:) glutaminase-asparaginase

SCOPe Domain Sequences for d3pga3_:

Sequence, based on SEQRES records: (download)

>d3pga3_ c.88.1.1 (3:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]}
klanvvilatggtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqias
esitnddllklgkrvaeladsndvdgivithgtdtleetayfldltlntdkpivvvgsmr
pgtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawg
plgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngak
alihagtgngsvssrltpalqtlrktgtqiirsshvnqggfvlrnaeqpddkndwvvahd
lnpekarilvelamvktqdskelqrifwey

Sequence, based on observed residues (ATOM records): (download)

>d3pga3_ c.88.1.1 (3:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]}
klanvvilatgtiagagasaansatyqaakvgvdkliagvpeladlanvrgeqvmqiase
sitnddllklgkrvaeladsndvdgivithgtdtleetayfldltlntdkpivvvgsmrp
gtamsadgmlnlynavavasnkdsrgkgvlvtmndeiqsgrdvsksinikteafksawgp
lgmvvegksywfrlpakrhtvnsefdikqisslpqvdiaysygnvtdtaykalaqngaka
lihagtgngsvssrltpalqtlrktgtqiirsshvnqggfvlrnaeqpddkndwvvahdl
npekarilvelamvktqdskelqrifwey

SCOPe Domain Coordinates for d3pga3_:

Click to download the PDB-style file with coordinates for d3pga3_.
(The format of our PDB-style files is described here.)

Timeline for d3pga3_: