Lineage for d6amla_ (6aml A:)

  1. Root: SCOPe 2.08
  2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. Superfamily c.1.9: Metallo-dependent hydrolases [51556] (19 families) (S)
    the beta-sheet barrel is similarly distorted and capped by a C-terminal helix
    has transition metal ions bound inside the barrel
  5. Family c.1.9.3: Phosphotriesterase-like [51564] (3 proteins)
    automatically mapped to Pfam PF02126
  6. Protein automated matches [190258] (3 species)
    not a true protein
  7. Species Brevundimonas diminuta [TaxId:293] [194088] (25 PDB entries)
  8. Domain d6amla_: 6aml A: [355688]
    automated match to d1qw7a_
    complexed with cac, mpd, zn

Details for d6amla_

PDB Entry: 6aml (more details), 1.46 Å

PDB Description: phosphotriesterase variant s8
PDB Compounds: (A:) phosphotriesterase

SCOPe Domain Sequences for d6amla_:

Sequence, based on SEQRES records: (download)

>d6amla_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrasaag
vrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqaa
ileseglspsrvcighsdaaddlsyhtalaargyligldsiphsavglgdnasasahlgi
rswqtrallikalidqgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvip
flrekgipqetlagitvtnparflsptlr

Sequence, based on observed residues (ATOM records): (download)

>d6amla_ c.1.9.3 (A:) automated matches {Brevundimonas diminuta [TaxId: 293]}
drintvrgpitiseagftlthehicgssagflrawpeffgsrkalaekavrglrrasaag
vrtivdvstfdlgrdvsllaevsraadvhivaatglwldpplsmrlrsveeltqfflrei
qygiedtgiragiikvattgkvtpfqelvlraaaraslatgvpvtthtaasqrggeqqaa
ileseglspsrvcighsdaaddlsyhtalaargyligldsiphsavswqtrallikalid
qgytkqilvsndwlfgissyvtnimdvmdsgnpdgmafiplrvipflrekgipqetlagi
tvtnparflsptlr

SCOPe Domain Coordinates for d6amla_ are not available.

Timeline for d6amla_:

Domains from other chains:
(mouse over for more information)
d6amlg_