Lineage for d5zqcb_ (5zqc B:)

  1. Root: SCOPe 2.08
  2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. Family e.3.1.0: automated matches [191512] (1 protein)
    not a true family
  6. Protein automated matches [190857] (70 species)
    not a true protein
  7. Species Listeria monocytogenes [TaxId:169963] [355271] (5 PDB entries)
  8. Domain d5zqcb_: 5zqc B: [355660]
    automated match to d5tr7b_
    complexed with aix, gol

Details for d5zqcb_

PDB Entry: 5zqc (more details), 1.7000000000000002 Å

PDB Description: crystal structure of penicillin-binding protein d2 from listeria monocytogenes in the ampicillin bound form
PDB Compounds: (B:) Lmo2812 protein

SCOPe Domain Sequences for d5zqcb_:

Sequence, based on SEQRES records: (download)

>d5zqcb_ e.3.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld
lvrlddpsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqak
klgmsskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgak
lestndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdtekl
mevgfk

Sequence, based on observed residues (ATOM records): (download)

>d5zqcb_ e.3.1.0 (B:) automated matches {Listeria monocytogenes [TaxId: 169963]}
pnlylsanaaavysvengealyeqnadkvmpiaslsklmtaflvleavdnnelswdekld
lvrlsavslyaitqkrtwsvrdlysamltmsandaaetlgdrldgadfpkemnnqakklg
msskttfvsasgldvdgksavsttkdlfllssklisthpevlettskptvttdkgakles
tndllgsiqgldglktgftdeagycfigtaerggkrvisivldagtaekrfkdteklmev
gfk

SCOPe Domain Coordinates for d5zqcb_ are not available.

Timeline for d5zqcb_:

Domains from other chains:
(mouse over for more information)
d5zqca_, d5zqcc_, d5zqcd_