Class a: All alpha proteins [46456] (289 folds) |
Fold a.99: Cryptochrome/photolyase FAD-binding domain [48172] (1 superfamily) multihelical; consists of two all-alpha subdomains |
Superfamily a.99.1: Cryptochrome/photolyase FAD-binding domain [48173] (2 families) automatically mapped to Pfam PF03441 |
Family a.99.1.0: automated matches [231382] (1 protein) not a true family |
Protein automated matches [231383] (3 species) not a true protein |
Species Chlamydomonas reinhardtii [TaxId:3055] [355320] (3 PDB entries) |
Domain d6fn3a2: 6fn3 A:208-494 [355650] Other proteins in same PDB: d6fn3a1 automated match to d4i6ga2 complexed with fad, gol, mes, po4 |
PDB Entry: 6fn3 (more details), 1.9 Å
SCOPe Domain Sequences for d6fn3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d6fn3a2 a.99.1.0 (A:208-494) automated matches {Chlamydomonas reinhardtii [TaxId: 3055]} ltvfkggetealarleaafqdpkwvagfqkpdtdpsawekpattvlspylkfgclsarlf harllevyrrhpahsqppvslrgqllwreffytvgsttpnfhrmagnpvckqidwddnpe flaawreartgfpwidaimtqlvtwgwmhhlarhsvacfltrgdlyvswergmevfeehl idqdhylnaanwmwlsasaffsqyfrvyspvvfgkkydpegrfirkflpvlkdmpakyiy epwtaplevqrkagcvvgrdypapivdhavaskaciarmaaayrrsk
Timeline for d6fn3a2: