Lineage for d1agx__ (1agx -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 27887Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
  4. 27888Superfamily c.88.1: Glutaminase/Asparaginase [53774] (1 family) (S)
  5. 27889Family c.88.1.1: Glutaminase/Asparaginase [53775] (2 proteins)
  6. 27908Protein Glutaminase-asparaginase [53780] (2 species)
  7. 27909Species Acinetobacter glutaminasificans [TaxId:474] [53781] (1 PDB entry)
  8. 27910Domain d1agx__: 1agx - [35564]

Details for d1agx__

PDB Entry: 1agx (more details), 2.9 Å

PDB Description: refined crystal structure of acinetobacter glutaminasificans glutaminase-asparaginase

SCOP Domain Sequences for d1agx__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1agx__ c.88.1.1 (-) Glutaminase-asparaginase {Acinetobacter glutaminasificans}
knnvvivatggtiagagasstnsatysaakvpvdalikavpqvndlanitgiqalqvase
sitdkellslarqvndlvkkpsvngvvithgtdtmeetafflnlvvhtdkpivlvgsmrp
stalsadgplnlysavalassneaknkgvmvlmndsifaardvtkginihthafvsqwga
lgtlvegkpywfrssvkkhtnnsefniekiqgdalpgvqivygsdnmmpdayqafakagv
kaiihagtgngsmanylvpevrklhdeqglqivrssrvaqgfvlrnaeqpddkygwiaah
dlnpqkarllmalaltktndakeiqnmfwny

SCOP Domain Coordinates for d1agx__:

Click to download the PDB-style file with coordinates for d1agx__.
(The format of our PDB-style files is described here.)

Timeline for d1agx__: